IGF1 1mg (price is per vial)

20.00$ If paid in BTC 14.00$

In stock

Compare
Category:

IGF1 1mg

Click here to buy 10vials (1KIT) of IGF1 DES at a discounted price of $699!

1mg: 1vial

Shipping:

USA $10 (3-5 business days)

International : $40 (7-14 business days)

Minimum Order: 1vial

Product Usage: THIS PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY.
This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only.
All product information available on this website is for educational purposes only.
Bodily introduction of any kind into humans or animals is strictly forbidden by law.
This product should only be handled by licensed, qualified professionals.
This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.

IGF1 DES

Insulin-Like Growth Factor (IGF)-1 (4-70), otherwise known as IGF-1 DES, produced in E. coli, is a single, non-glycosylated, polypeptide chain containing 67 amino acids and having a molecular mass of 7,372 Da. In vitro studies demonstrate that at equal doses DES (1-3) IGF is ten times more potent than IGF-1 at stimulating hypertrophy and proliferation in cultured cells. It is likely generated through post-translational modification in the sequence of circulating mature IGF-1 via protease action.

IGF-1 DES is a cleaved form of IGF-1 and contains amino acids 4-70. This structure has allowed the effects of the IGF-1 protein to be amplified in the more stable form of the DES 1,3 molecule peptide protein fragment of Insulin-like growth factor 1. The IGF-1 DES, or insulin-like growth factor DES, comes from the IGF-1 family of peptides that play important roles in mammalian growth and development. IGF1 mediates many of the growth-promoting effects of growth hormone and IGF-1 DES, although shorter, pacts an equal amount of physiological altering protein physical changes. Early studies showed that growth hormone did not directly stimulate the incorporation of sulfate into cartilage, but rather acted through a serum factor, termed ‘sulfation factor,’ which later became known as ‘somatomedin’ or IGF-1 and more recently through truncation, DES IGF-1.

Insulin-Like Growth Factor-1 DES (1-3)

Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molar Mass: 7,372 Da

Synonyms: IGF-1 Des(1-3), Des1-3, Des 1-3, Des (1-3), IGF-1 (4-70)

All of our products are lab tested and the results are periodically published on the website.

We are negotiating and buying in bulk from top peptide and research chemical manufacturers from around the world to bring the end researcher wholesale discounted prices of the highest quality research chemicals. 

RESEARCH APPLICATION:
1. Swab the top of your IGF-1 vial with a sterile alcohol prep pad
2. Draw the dosage (e.g. 50mcgs) you wish to research with into the syringe and eliminate all bubbles and trapped air.
3. Then Back-load, which is diluting the IGF-1/AA solution that is in your syringe. The point is to dilute the acidity to a point that it will no longer cause tissue necrosis (death/damage) or pain upon injection. It is recommended to dilute no less than 4:1 ratio (4 parts BW to 1 part IGF-1/AA)
4. EXAMPLE: IGF-1 LR3: 2IUs of IGF-1 in the syringe then add 8IUs of BAC

Also known as: IGF-1 Des(1-3), Des1-3, Des 1-3, Des (1-3), IGF-1 (4-70)

Select your currency
USD United States (US) dollar
EUR Euro

IGF1 1mg (price is per vial)

20.00$ If paid in BTC 14.00$

Add to Cart