IGF1 DES 1mg (price is per vial)

$34.69 If paid in BTC $27.75

In stock

Click To Check Quantity Discount

Check the Quantity Discount Below
  • Qty 2 = 2% discount
  • Qty 3 = 4% discount
  • Qty 4 = 6% discount
  • Qty 5 = 8% discount
  • Qty more than 6 = 10% discount
Compare
Category:

IGF1 DES 1mg has to reconstituted with Bacteriostatic water (BAC).

You can purchase BAC water here:
BAC 10ml 
BAC 20ml 

Click here to buy 10vials (1KIT) of IGF1 DES at a discounted price of $699!

Total amount of active ingredient: 1mg (1vial)

Top Color: Blue

Shipping:
USA: $11.95 (3-5 business days)
International : $49.95 (7-14 business days)
If your shipment was seized (International Orders), we will provide a 50% discount applicable on your next purchase. Please contact us for more information.
Minimum Order: 1vial

IGF1 DES

Insulin-Like Growth Factor (IGF)-1 (4-70), otherwise known as IGF-1 DES, produced in E. coli, is a single, non-glycosylated, polypeptide chain containing 67 amino acids and having a molecular mass of 7,372 Da. In vitro studies demonstrate that at equal doses DES (1-3) IGF is ten times more potent than IGF-1 at stimulating hypertrophy and proliferation in cultured cells. It is likely generated through post-translational modification in the sequence of circulating mature IGF-1 via protease action.

IGF-1 DES is a cleaved form of IGF-1 and contains amino acids 4-70. This structure has allowed the effects of the IGF-1 protein to be amplified in the more stable form of the DES 1,3 molecule peptide protein fragment of Insulin-like growth factor 1. The IGF-1 DES, or insulin-like growth factor DES, comes from the IGF-1 family of peptides that play important roles in mammalian growth and development.

IGF1 mediates many of the growth-promoting effects of growth hormone and IGF-1 DES, although shorter, pacts an equal amount of physiological altering protein physical changes. Early studies showed that growth hormone did not directly stimulate the incorporation of sulfate into cartilage, but rather acted through a serum factor, termed ‘sulfation factor,’ which later became known as ‘somatomedin’ or IGF-1 and more recently through truncation, DES IGF-1.

Insulin-Like Growth Factor-1 DES (1-3)

Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molar Mass: 7,372 Da

Synonyms: IGF-1 Des(1-3), Des1-3, Des 1-3, Des (1-3), IGF-1 (4-70)

All of our products are lab tested and the results are periodically published on the website.

IGF1 DES 1mg (price is per vial) 3

RESEARCH APPLICATION:
1. Swab the top of your IGF-1 vial with a sterile alcohol prep pad
2. Draw the dosage (e.g. 50mcgs) you wish to research into the syringe and eliminate all bubbles and trapped air.
3. Then Back-load, which is diluting the IGF-1/AA solution that is in your syringe. The point is to dilute the acidity to a point that it will no longer cause tissue necrosis (death/damage) or pain upon injection. It is recommended to dilute no less than 4:1 ratio (4 parts BW to 1 part IGF-1/AA)
4. EXAMPLE: IGF-1 LR3: 2IUs of IGF-1 in the syringe then add 8IUs of BAC

Also known as: IGF-1 Des(1-3), Des1-3, Des 1-3, Des (1-3), IGF-1 (4-70)

 

Peptides are stable at room temperature and can be kept in their initial packaging for several days to weeks. Otherwise, peptides can be stored at 4 °C or colder. Peptides should be protected from intense light.

Additional information

Weight 0.5 kg
Select your currency
USD United States (US) dollar
EUR Euro

IGF1 DES 1mg (price is per vial)

$34.69 If paid in BTC $27.75

Add to Cart